geni-act :: genomes :: Myxococcus xanthus DK 1622 CP000113 :: MXAN_0001
Browse
History

left MXAN_7513 MXAN_7514 MXAN_0001 MXAN_0002 gene_browser right


Locus
MXAN_0001
Coordinates
87..1439
Length
1353/450
Gene Name
Gene Products
chromosomal replication initiator protein DnaA
Note
identified by match to protein family HMM PF00308;match to protein family HMM TIGR00362
Discussion
<blank>
Literature Links
<none>
Synonyms
  • MXAN0001
  • MXAN1
  • MXAN_1
  • Mx_5303
  • ORF06710
  • ORF6710
  • GMXORF5732
  • UniProtKB/TrEMBL:Q1DGD6
Experimental Data
<none>
Lab Notebooks
<none>
Nucleotide Sequence - raw
87..1439
1
GGCCGGTTGCTTGATCCACCAGGAACCGTCTGTTAGCACCGCCGAACGCCTCGTTTTCCCCCTG
CTCCTGCACGTTTGAGTCCCGCGTGAACGCCCTCGCCCAAGCCGCTACCCCCCTCCCAAGTGCT
GGAATTCTCTGGGCTCGGATGCTGGATGCCATCCGCCAGGAGAAGTTCGACTACGCGCTGAGAT
GGCTGGAGCGGATGCGCCCGCTGGAGGTGCGTGACGGTGCCCTGGTGATGGGCGTTCCGGACCG
CTTCTTCCGCGACTGGGTGGATGACCACTACCGCCCCATGCTGGATGTCCAGCTCGCACGGATG
GGGGAGGGCCTGACCTCCATCGCCTATGAGGTAGTGGAGGGCCTGGAGCCGGACCCGCATTTTC
CACCCACACCCTCAGTCAAGGCGAGCGCCACGCGTCCGGGCCGGCTGAACGCGCGCTTCACCTT
CGACACCTTCGTGGTGGCGGACAGCAACCAGCTCCCGGCCGCCGCGGCGCAGGCCGTGGCCGAC
AAGCCGGGCCACCACTACAACCCGCTCTACATCTACGGCGGCACGGGTCTGGGCAAGACGCACC
TGCTCCAGGCAGTGGGCAACCTCATCTGGGAGCGAGATCCATCCCAGCGCGTGGTGTTCCTCTC
CAGCGAGCAGTTCACCAACGAGTACGTGGAGAGCGTCCGCGAGCACCGCATGGGGGACTTCCGC
CGGAAGTTCCGTGAGGAGTGCGACGTGCTCCTCCTCGACGACATCCAGTTCCTCGGCAAGCGTG
AGGAGACGCAGAAGGAGTTCTTCTACACCTTCAACACGCTCTACGAGATGAACAAGGCCATCGT
CCTCACCAGCGACACCGTGCCCGCGGAGATTCCGGGCCTGGAGGACCGGCTGCGCAGCCGCTTC
GCCATGGGGCTGATGACGGACATCCGCGAGCCCACCTACGAGACGCGGGTGGCCATCCTCCAGA
AGAAGGCCGTGGCCGAAGGTCTGGACCTGCCGGACTCGGTGGCGCACTTCATCGCCAAGCACAT
CCAGAAGAACGTGCGCGAGTTGGAAGGCGCGCTGGTGAAGCTGTCCGCGGTGCACAGCCTGACG
CGCCAGCCCGTGACGGAGGACTTCGCGTCCCAGGTGCTGCGCGACATCCTCCCCGCCCACAGCG
CGGTGGACGTGGAGGCCATCCAGCGCGAGGTGGCCCGCTTCTACAAAGTCACGGTGGAGTCGCT
GAAGGAAGACCGCCGGCACAAGGCCCTGGCCCATGCGCGCCAGGTGGCCATGTACCTCAGCCGC
AAGCTGACGAAGAGCTCCTTCCCGGAAATCGCCGCGCGCTTCAGCAAGGACCACTCCACCGTCA
TCTCCGCGGTTCGCAAGGTGGAAGGCCTCCGCGTGACGGATGCCACCGTGCAGCGTGAGTTGGC
GGAGCTGGAATTGAAGCTCGGCAATCCCTGAAACAGCCGTACCTTTGTTTCATGTCGGACGACA
CGCGCCCGCGTGAAACGGGCCGTGTCCGGCTGACGCGCAACCAGGATTGACGCTCGGGCGCGTA
TGCGGGGGAGTGAGCCCGCGCCTGAAGAGCCTGGTCCTTCTGCTCGCCGTGCTCACGGCAGCCG
CGCTGTGGCGTGCGGGCCAGGAGACACAGACGCCGGCTTCTCCTGAGACACCGCCGGCTGTCTC
ACCGTCCTTGGATGATGAAGCCCTCACACCGGCTCCCGAGGAAAACCTTCCAGGCGTGAAGGGG
CGGGAGCGGGTGCTCGTCGTGGGCCACCGGCTTCGTTACACGTTCGACCTGGACCTCCGGACCC
ACACGGAGAATCGGGCCGGCGCGCGCGAGTCCCTGCACACCGGATGGAGCGGCCTGTTCGAGCT
CACCTACCTGGGCGCGGAGGGTGAACAGCACCTGTTCTCCGGCCACCTCGTGCCCACGCGGGTG
GCCGTGGAATCCGGTGAGA
1939 edit
Amino Acid Sequence - raw
87..1439
pI: 6.525783538818359
1
MNALAQAATPLPSAGILWARMLDAIRQEKFDYALRWLERMRPLEVRDGALVMGVPDRFFRDWVD
DHYRPMLDVQLARMGEGLTSIAYEVVEGLEPDPHFPPTPSVKASATRPGRLNARFTFDTFVVAD
SNQLPAAAAQAVADKPGHHYNPLYIYGGTGLGKTHLLQAVGNLIWERDPSQRVVFLSSEQFTNE
YVESVREHRMGDFRRKFREECDVLLLDDIQFLGKREETQKEFFYTFNTLYEMNKAIVLTSDTVP
AEIPGLEDRLRSRFAMGLMTDIREPTYETRVAILQKKAVAEGLDLPDSVAHFIAKHIQKNVREL
EGALVKLSAVHSLTRQPVTEDFASQVLRDILPAHSAVDVEAIQREVARFYKVTVESLKEDRRHK
ALAHARQVAMYLSRKLTKSSFPEIAARFSKDHSTVISAVRKVEGLRVTDATVQRELAELELKLG
NP
1939 edit