geni-act :: genomes :: Myxococcus xanthus DK 1622 CP000113 :: MXAN_7514
Browse
History

left MXAN_7513 MXAN_7514 MXAN_0001 MXAN_0002 gene_browser right


Locus
MXAN_7514
Coordinates
9137734..9139602
Length
1869/622
Gene Name
Gene Products
hypothetical protein
Note
identified by Glimmer2; putative
Discussion
<blank>
Literature Links
<none>
Synonyms
  • MXAN7514
  • Mx_5302
  • ORF06712
  • ORF6712
  • GMXORF5734
  • UniProtKB/TrEMBL:Q1CVF6
Experimental Data
<none>
Lab Notebooks
<none>
Nucleotide Sequence - raw
9137734..9139602
9137234
GGTCCCCGTCACGATCGGCGCCAAGGTGGCCGGCGTGGTGGGGCTCGAATACGGGTTGTCGGCG
GATCACAAGGTGACGGGCACCACGGCGTGCAGCGTGACGAGCGTGGGCATCACCGGACACGTGC
AGCCCTACGCGCAGGTGGACGGTGAGCTGTACGCGAGCGTCGACCTCTTCGTCATCGAGGCGGG
CGTGAAGGGGCGCCTCCAACTGGTCCACGCCGCCGTCCCGCTCAACGCCAACGTCTGGCTGTCG
CCGGTCGGAGGCAGGGTGAAGCTGCGCATGGAGGGGAACTCCGACCTGCGCTTCACCTTCCTGT
CCGGCAGCATCTCCGCCTACGTGGAAGTGGGCATCTGGCCCTTCGAAACGGAGTTCGAGGAGAC
GCTCGTGAGCTGGAACGGCATCACCGAGAACGTGAAGTTGTTCGACCACTCGTTCAACGTCGAC
CTCCTCGACCTCCGCTCCCTGCTGTAATCCCCGTACCTGCTGGAGACGCCCCATGAACGCACGC
AAGGTCATCACTGGCGGTGCACTGCTGGCACTGCTGCTCCTGGGAGCCGCCTGGCTCTTCCACA
CCCAGGCCCCCGTCACCGGGGCGCCTCCAGCGGCGACGCCCCTCCGCGTCCACTTCCCCGTGGG
GGAGCGCCGGACGTACCGCATGGACTACACGGCCCGGACCGAGGTGCGCCTCGCCGGGTCGCAA
CAGAAACCCACCGCCATGGGGGGCCGGGCCCACTTCGTTGGAGACCTGGTCCTCCGCGGCCACC
CCGCGCAGGGCACCGCCCTGCGCGTGGGGCTGAGCCTGGAGAACCTCCACGAGCACACGCTCGA
GCTGTTTGGCCACGCGCTGCTGCCAGACGCCGCGGCCGTCGCGGCCACCTTCACCGGCCGCGAG
GCCCTGCTGGACCTGGACGCCGACGGCACCCTGCGCGCCGTCTCCTTCCAGGAGGAAGACCCCT
CCCTCTTCAAGAACACCGTGCAGACGCTGGCCGGCGAGCTCCAGTGGGTGCTGCGCGACGGCGC
CACCTGGCAGGTGGAGGAGCTGACGTCGCGAGGCACGGCCCTCACGGAGTACGCGCGGCTGGAC
GAAGGCGCCCTGCCCGCGCGCATCCTCAAGCGGCGCCTGGCCTACCCGGAGCCCCGCGGCATGG
GCACGGGCAGCGGCGCCGTGGAGGTGGACTCGCGCTTCGAGATGACGCTGGACGCGGACGGCGT
CCTGGAGCGGCTCTCCGGTGAAGAGCGGGTGCTCCGCCGCCCGACCGGTGGCGGCGAACCCACC
GCCACCTCGCACATCCAGCTCCGCCTGGAGCCCGGCAAGCGGGACCGGTTCGTGGTGGCGCAGG
CCTCCGCCGCGCCCGCCGCGCCGCTCCAAAAGCTCGCGCCGGGCGAACTGGTGACGGACGCCCA
CGCGCGGGAGCGGATGCTGGAGCAGCAGGTGGATGGGCTCACCCCGGAGCGCTTCTTCGAGCTG
ATGGAGAAGTACGCCAACGGCGGCACCTTCCCGGAACACAACCACTTCCTCCTCCAAGCCACGG
GCCTGCTAGAGCAGCAGCCCGAGCTGTGTGCGCGGCTGGCCGACTTCTTCCAGCAGTCCACCCT
GAAGCCGCGGGGCCGGGCGCTGGTGCTGGACCTGCTGGCGGGCACGGGCACGCCGGAGGCGCAG
ACGGCGCTGGTGCGCGCCCTGTCCAGCCCCCAGGCGCTGGCCGAGCCCGGCTACGGCATGTTGC
TCAGCCGCCTGTCGCTGCTGACCAGCCCCACCCCCGACACGGTGCGCTTCATCGAACGCACCCA
CCGCACGGCCCGTGACGACACCCGCGTGGCCACCGCCTACGCCCTGGGCGCCACCGCCGGCGCC
CTCTACCGGCAGCAGCAGGACGCGGAGTCCCTGGCCGCCGTCCAGCAGCTCGGGGCCGAGCTGC
GCGCCGCGCGCACGCCCGAGGACAAGGCCCACCTGCTGCTCGCGCTGGGCAACGCGGGCCTGGA
GGAGCAGGTGGACGTCATCGCCCACTACGCCCAGGACGCGGACGCACAGGTGCGCCGGGCCTCG
GCCCGCGCGCTGCGGAAGATTCAGACGCCCCAGGCCATGCGCACGCTCCTCTCCATGACCGAGG
ACACCGACGCGCCCGTGCAGTCCTCCGCGCTGACGGCGCTGGGCCGCCGGGACCTGGACGAATC
GGCCCTGCGCCAACTGCGCGACCTGGCCCTCTCCGGCCGCGTGCCCGTGGAAAACCACCACACC
CTGGTGACGGTGGTGGAGCCCTACCTCCAGCGAGCACCCGAGGTGCGCCAGCTCCTCCAGCACC
TGCTCACCCAGGACGTGCCTGACGCCCAGCTCCACACGCGCATCCGAGGCCTGCTCGGGACGTG
A
9139602 edit
Amino Acid Sequence - raw
9137734..9139602
pI: 6.168071746826172
9137234
MNARKVITGGALLALLLLGAAWLFHTQAPVTGAPPAATPLRVHFPVGERRTYRMDYTARTEVRL
AGSQQKPTAMGGRAHFVGDLVLRGHPAQGTALRVGLSLENLHEHTLELFGHALLPDAAAVAATF
TGREALLDLDADGTLRAVSFQEEDPSLFKNTVQTLAGELQWVLRDGATWQVEELTSRGTALTEY
ARLDEGALPARILKRRLAYPEPRGMGTGSGAVEVDSRFEMTLDADGVLERLSGEERVLRRPTGG
GEPTATSHIQLRLEPGKRDRFVVAQASAAPAAPLQKLAPGELVTDAHARERMLEQQVDGLTPER
FFELMEKYANGGTFPEHNHFLLQATGLLEQQPELCARLADFFQQSTLKPRGRALVLDLLAGTGT
PEAQTALVRALSSPQALAEPGYGMLLSRLSLLTSPTPDTVRFIERTHRTARDDTRVATAYALGA
TAGALYRQQQDAESLAAVQQLGAELRAARTPEDKAHLLLALGNAGLEEQVDVIAHYAQDADAQV
RRASARALRKIQTPQAMRTLLSMTEDTDAPVQSSALTALGRRDLDESALRQLRDLALSGRVPVE
NHHTLVTVVEPYLQRAPEVRQLLQHLLTQDVPDAQLHTRIRGLLGT
9139602 edit