geni-act :: genomes :: Myxococcus xanthus DK 1622 CP000113 :: MXAN_7513
Browse
History

left MXAN_7509 MXAN_7510 MXAN_7511 MXAN_7512 MXAN_7513 MXAN_7514 gene_browser right


Locus
MXAN_7513
Coordinates
9135282..9137708
Length
2427/808
Gene Name
Gene Products
hypothetical protein
Note
identified by Glimmer2; putative
Discussion
<blank>
Literature Links
<none>
Synonyms
  • MXAN7513
  • Mx_5301
  • ORFC00809
  • ORFC809
  • GMXORF5734.1
  • UniProtKB/TrEMBL:Q1CVF7
Experimental Data
<none>
Lab Notebooks
<none>
Nucleotide Sequence - raw
9135282..9137708
9134782
TCCGCTTGCGGAACCCGTGGGCGCGATTGCGGCGGACCTTCGACGGCTGGTACGTGCGCTTGGA
CACGGCTCTTACTCCTTGGTGATGACGGCGGCGCCTCCTACCGCTCCGGCGCGACCTGAACTAG
GGAAAGGGGCGGGTCCGTACCCCCATTTCCAGGGTAAGTCAACGTTGGATCACCCTGGCCCACC
CGGGAACCCACGCCCGGAGGCCCGATCGGACCGCCTGAGGTAGGGCCATGAAGGCTTGGGTGCT
ACTGACGGTGCCGACCACCGCCCAACGCACGGCGGCGGGAGTCTAACCGCGAACAGCGTGGACG
TCTGTTTCCCTGGCGCTTCTTTCGAGTGAGTGCCTGCCAGCCCGGGCGCCCAACGGCCTCAGAC
TCGCAATAACTGAGAGCGCTGGGGGTCGCGGATACCCATCCAGAGACACCATCATTTTTTTGCG
AAGGACCTTTTGAAGGCCCGTTCTTCCGCAAACCCCACACAAAGGTGTCCACATGTCGTTGCTC
ACGCGGCCTCAGGTCGTCGTGCTCGGACTTGTCATGTCCTCTGCGCCCGCCCTGGCCCAATCGT
TCCCCCCCGTCCTCCCGCCGCTGAACCCCATCCTCCTCTGTAATTCCTACGTCCCCACGCTCGA
AGAGTGCCAGAACCCCGTCACCTTCTGCGCGAACATGGCCCGGAGCGCGGCGAAGACCAACCCG
AACGCCGCCTGCAACGTCCTGGTGCGCGACGCCGCGCTGAACGCCGTGGCGAGCCTGCCCGAGC
GCACCGTGCTGGTGCCCATCACCCGCAACGCGAGCGGCCAGGAGATTGCGCCAGACGCCGCCAC
CAAGAGCGTGGCCTTCGTCGAGGAGAACCCGAACGCCCGCTACATGAGCGGCCTCTCCAGCTTC
ATGCTGGGCACCGCGCACCGCGACCGGACCTACTTCCCCGCGTCGACCAAGACGGCCACCCTCA
TGCGCTTCGCGCGCCTCTCCCAGCGAAACGCGTGGAACAACTCCGGCAACACCGTCGACTCCTG
CCGCGAGTACGTCCACGAGAAGTACTACGACTACAGCGTCTTCGAGGACGCCATCTCCTCCGCG
GGCACCGACTACCGCAAAATCTTCGACATCGCCTACGCCCAGGCGCCCAGCGGCGGCAGCGTGC
CCGCCTCCGCCATTGGCACCCGCTCGATTGCGGACCCGGTGCAGCGCGGCAAGGACGGCACCCC
TATCCAACCCGCCATCCAGTTCCCCGCCGGCGCGCCGAAGAACGAGTTCTTCACCGTGCCGCCT
CCCGTACAGGGCAAGGTCACCATCAGCGCCAGCAACGTGGACCGGGTGGTCGTGGTTCCAGGCG
GGAGGGGCGTGGCCTTCATCGAGCTCAAGGACCTGGACCGTCCGCTGAACCTCTACGGCACCAT
CCTGCCCGAGGCGACGCTGTCCACCCTGGCGAACGGCGCCAGCTACTACAACGAGAGCTGGGCG
TGGCACCGAAGCATGAGCACCATTCGCAACGCCAACGTCCTGGATGAGCGGATGTACGAACTGG
ACCGGCTCCAGGAGGAGTTCGCCGCGCTCGTCCAGCAGCGCAAGGACCTGGTCAGCTCCATCCA
GGTGGAGCTGGCCCGGCGCTACCAGCCCATCCAAGGGTTCCTGAAGGCCGAGCCGGAAACGTCC
AGCAACCTGACGGACGACGACGAGCCCCAGGACCCGGTCGTCACCCAGCTCTACCAGTTGGCCT
CGCTGGATGCCGTCATCGAAGCGGCGCTCCAGCAGGCCCAGGCGAAAGGCTGCCTCAACTTCCA
GATTGGCAAGGCCGCCGCTCCCTGCGACTGGTCGCCCAAGCGCTTCGCGCGCAGGGTGATGAAC
CTCTACCAGGGCGCGCGTGAGCAGGACTTCCAGAAGTGCTCGACCTATACCCGCGACGACTTCG
CGGACCTCAAGGCCAGGCCCCTGCAGATTGGCACCGTCAACTACCCCGCGCAGGACTACACGAC
GAGCCCCTCGCGCCTGGAGACGTACTTCACCCGACGGGACCAGTACATGCGCGCCCTGTCCTCC
ACGGTGGGGCCCATGCTGGATCCGAAGACGGCGCAGCCCCGCCTGCGCTGGGAGTCCGGTGACA
GCTACAGCCTGGGCAATGACACCTTCGGCGCCACCGCGAACTACCAGGTGGCCGTGGCCATCAA
CAACGTGAAGAACACGCCCGACTGCGGCCTCTCCCCGGAGGTGACGGGCAGCTTCACCGCCACC
GGCAGCGCCCTGGGCATCAGCGCCAACCTCATCAACGCCCAGGTGAATGTGACGCAGAAGCGCG
CGGACATCGACCTGGACGTGCTCGACAACACCGTGCCGCTGGTGGACATCCACAAGAACCTGAC
GCTGGGCCAGTTCAACATCGTGTCCGGCAAGCAGGAGAAGAAGGCCACGCTGGTGAGCGCGCAG
GCCACCTTCGTCATCGTGGTGGTCCCCGTCACGATCGGCGCCAAGGTGGCCGGCGTGGTGGGGC
TCGAATACGGGTTGTCGGCGGATCACAAGGTGACGGGCACCACGGCGTGCAGCGTGACGAGCGT
GGGCATCACCGGACACGTGCAGCCCTACGCGCAGGTGGACGGTGAGCTGTACGCGAGCGTCGAC
CTCTTCGTCATCGAGGCGGGCGTGAAGGGGCGCCTCCAACTGGTCCACGCCGCCGTCCCGCTCA
ACGCCAACGTCTGGCTGTCGCCGGTCGGAGGCAGGGTGAAGCTGCGCATGGAGGGGAACTCCGA
CCTGCGCTTCACCTTCCTGTCCGGCAGCATCTCCGCCTACGTGGAAGTGGGCATCTGGCCCTTC
GAAACGGAGTTCGAGGAGACGCTCGTGAGCTGGAACGGCATCACCGAGAACGTGAAGTTGTTCG
ACCACTCGTTCAACGTCGACCTCCTCGACCTCCGCTCCCTGCTGTAATCCCCGTACCTGCTGGA
GACGCCCCATGAACGCACGCAAGGTCATCACTGGCGGTGCACTGCTGGCACTGCTGCTCCTGGG
AGCCGCCTGGCTCTTCCACACCCAGGCCCCCGTCACCGGGGCGCCTCCAGCGGCGACGCCCCTC
CGCGTCCACTTCCCCGTGGGGGAGCGCCGGACGTACCGCATGGACTACACGGCCCGGACCGAGG
TGCGCCTCGCCGGGTCGCAACAGAAACCCACCGCCATGGGGGGCCGGGCCCACTTCGTTGGAGA
CCTGGTCCTCCGCGGCCACCCCGCGCAGGGCACCGCCCTGCGCGTGGGGCTGAGCCTGGAGAAC
CTCCACGAGCACACGCTCGAGCTGTTTGGCCACGCGCTGCTGCCAGACGCCGCGGCCGTCGCGG
CCACCTTCACCGGCCGCGAGGCCCTGCTGGACCTGGACGCCGACGGCACCCTGCGCGCCGTCTC
CTTCCAGGAGGAAGACCCCTCCCTCTTCAAGAACA
9138208 edit
Amino Acid Sequence - raw
9135282..9137708
pI: 5.540073394775391
9134782
MSLLTRPQVVVLGLVMSSAPALAQSFPPVLPPLNPILLCNSYVPTLEECQNPVTFCANMARSAA
KTNPNAACNVLVRDAALNAVASLPERTVLVPITRNASGQEIAPDAATKSVAFVEENPNARYMSG
LSSFMLGTAHRDRTYFPASTKTATLMRFARLSQRNAWNNSGNTVDSCREYVHEKYYDYSVFEDA
ISSAGTDYRKIFDIAYAQAPSGGSVPASAIGTRSIADPVQRGKDGTPIQPAIQFPAGAPKNEFF
TVPPPVQGKVTISASNVDRVVVVPGGRGVAFIELKDLDRPLNLYGTILPEATLSTLANGASYYN
ESWAWHRSMSTIRNANVLDERMYELDRLQEEFAALVQQRKDLVSSIQVELARRYQPIQGFLKAE
PETSSNLTDDDEPQDPVVTQLYQLASLDAVIEAALQQAQAKGCLNFQIGKAAAPCDWSPKRFAR
RVMNLYQGAREQDFQKCSTYTRDDFADLKARPLQIGTVNYPAQDYTTSPSRLETYFTRRDQYMR
ALSSTVGPMLDPKTAQPRLRWESGDSYSLGNDTFGATANYQVAVAINNVKNTPDCGLSPEVTGS
FTATGSALGISANLINAQVNVTQKRADIDLDVLDNTVPLVDIHKNLTLGQFNIVSGKQEKKATL
VSAQATFVIVVVPVTIGAKVAGVVGLEYGLSADHKVTGTTACSVTSVGITGHVQPYAQVDGELY
ASVDLFVIEAGVKGRLQLVHAAVPLNANVWLSPVGGRVKLRMEGNSDLRFTFLSGSISAYVEVG
IWPFETEFEETLVSWNGITENVKLFDHSFNVDLLDLRSLL
9138208 edit