geni-act :: genomes :: Myxococcus xanthus DK 1622 CP000113 :: MXAN_0002
Browse
History

left MXAN_7513 MXAN_7514 MXAN_0001 MXAN_0002 gene_browser right


Locus
MXAN_0002
Coordinates
1519..3420
Length
1902/633
Gene Name
Gene Products
hypothetical protein
Note
identified by Glimmer2; putative
Discussion
<blank>
Literature Links
<none>
Synonyms
  • MXAN0002
  • MXAN2
  • MXAN_2
  • Mx_5304
  • ORF06709
  • ORF6709
  • GMXORF5731
  • UniProtKB/TrEMBL:Q1DGD5
Experimental Data
<none>
Lab Notebooks
<none>
Nucleotide Sequence - raw
1519..3420
1019
GCACATCCAGAAGAACGTGCGCGAGTTGGAAGGCGCGCTGGTGAAGCTGTCCGCGGTGCACAGC
CTGACGCGCCAGCCCGTGACGGAGGACTTCGCGTCCCAGGTGCTGCGCGACATCCTCCCCGCCC
ACAGCGCGGTGGACGTGGAGGCCATCCAGCGCGAGGTGGCCCGCTTCTACAAAGTCACGGTGGA
GTCGCTGAAGGAAGACCGCCGGCACAAGGCCCTGGCCCATGCGCGCCAGGTGGCCATGTACCTC
AGCCGCAAGCTGACGAAGAGCTCCTTCCCGGAAATCGCCGCGCGCTTCAGCAAGGACCACTCCA
CCGTCATCTCCGCGGTTCGCAAGGTGGAAGGCCTCCGCGTGACGGATGCCACCGTGCAGCGTGA
GTTGGCGGAGCTGGAATTGAAGCTCGGCAATCCCTGAAACAGCCGTACCTTTGTTTCATGTCGG
ACGACACGCGCCCGCGTGAAACGGGCCGTGTCCGGCTGACGCGCAACCAGGATTGACGCTCGGG
CGCGTATGCGGGGGAGTGAGCCCGCGCCTGAAGAGCCTGGTCCTTCTGCTCGCCGTGCTCACGG
CAGCCGCGCTGTGGCGTGCGGGCCAGGAGACACAGACGCCGGCTTCTCCTGAGACACCGCCGGC
TGTCTCACCGTCCTTGGATGATGAAGCCCTCACACCGGCTCCCGAGGAAAACCTTCCAGGCGTG
AAGGGGCGGGAGCGGGTGCTCGTCGTGGGCCACCGGCTTCGTTACACGTTCGACCTGGACCTCC
GGACCCACACGGAGAATCGGGCCGGCGCGCGCGAGTCCCTGCACACCGGATGGAGCGGCCTGTT
CGAGCTCACCTACCTGGGCGCGGAGGGTGAACAGCACCTGTTCTCCGGCCACCTCGTGCCCACG
CGGGTGGCCGTGGAATCCGGTGAGACGCTGGCGCCCGGTGACGCAGCGATGCAGGCGCTCCGGG
GCATGTTCGAGCGGCCGGTGTACGTGGGCCAGGACGTGCGGGGCCGGGTGATGGCCGTGCACTT
CGATGCGGCGCAGGACGCGACGGCGCGGCGGCTCGTGCGCCTGCTGCTCGCGTCGACGCAGTTC
GTGGCGGAGGACGGCCCCCGCTGGAGCACCGAGGAGCCGGACTCGCGCGGTGACCTCGAAGCCG
TGTACCGCGCGGGTGGCAGCGCGAACACCTACGTGAAGACGAAGCGGCGCTACCTGCGCGCTGG
CTCGGCGGTGCTTCCACGGCTGCAAGGGCACCTGGACTTCACCCTGTTCGCGGATGGGCACGTG
AAGGAAGCGACGGGCTCGGACGTGGTGGAGTTGGGCGGAGGCAGCACGGGGCTCCCTCGCATCC
GCGAGGAGGCGAGGGTCGCGTTGACCAACGTGGGCGTGGACTACCGGCTTTCGTCGCTGAGGCC
GTTTGAGGCCACGCGGACGACGTTGCGGTCGGAGCGGCTCACGGATTCGGCCGACATGGAGGGG
GCTTCGCTGGAGGCGCGGGACAGGCAGCTCGTGAAGGGGGTGAAGCTGGATGACTTGCTGCGGG
CACTGGCGAAGCGCGAGGACCTGGACACCGCGCGGCTGCGACTGACGGCCTTGTTCCGACAGAA
TCTGGCGGAAGTGGAACGAGCCGTGGCGCTGATTCGTCAGGGCTCCGCGGACGCGGTGCGCTCC
GAGCAGATACTGGAGGCGCTGGCCAGCGCGGGGACGCCAGAGGCGCAGCGGGCGCTGGTGTCCG
TGTTGGAGGGAGAACGGGTCCGGCCGAAGACCCGGGCCCACGCGGCACGGGCAGCGGGACGGAT
GGAACGGCCTTCGCTGCTGCTCGGTGATGCACTGGAGCGCGTGATGGATGGGACGCGGGACGCG
GGGGTGAGGAACGCGGCGGCGCTGTCGATGGGGGCGCTGTCGAAGACGTTGGAGGTGGCGGAGC
CGGGCCGGAGCCAGGCGCTGGTGGAGGGAATCGTGAGGCGCTGCCGCACGGGTGCTTTGGAGCC
CGAGGTCTGTCTGGATGCCCTGGCCCGGGCAGGTGCTCCGGTGGGATTGGCCTACGTGAAGTCG
GCGCTCGTGCATCCGGAGGCGGATGTTCGGGGCGCGGCGACGAAGGCACTGAGTGCCATTCCTG
GCGCGGCGGTGGATGCATTGTTGGACCAGGTGATGCTCGACGACCCGAGCCCGCGGGTTCGTGC
GCTCGCGGTGAAGGCTGTCTCTCAACGGGTCACTGGCGCCCACTTGGAAGTACTGGCCCGGGTG
CTGCGCTCCGAGCGGAGTGAGCGCGTCCGCATCGAAGTGGTGCGGCTGCTGGGCCACCTGCAAG
CCGTGGAGGCTCCCGCTGCGGCCCTGCTTCGCGATGTGGCCGCGAACGATGGGTCCGCGAACGT
ACGCGCGCTGGCGGCGTCACTGCTCGGCGAATAGGGCGGGGTGCCGGGCGGATGAGTTCACCTG
GCATCCGTTCCACTTCGAAGCGCTACGCGTCCTTGCGGCGACGGCCCATGACGACCCGCATCAG
TCCCGCGAGCATTCACGGAAGCAGTGCGGAAGGCACGCTCAGTGCGCAGCGGGGGGAGGGGCCT
CGGAGATGCTCTCCAGGGTCTCGCCGACGTCCTCCTCCGCCAGCGCCTCCAGCAAGTCGCCCAT
CGCGACAATCCCCACCAGCTTCTTGTCCCGGTCGAGCGCGAGGATGCGGCGGACCTTCTTCTCC
TTCATCTTCTCCGCCACCACGGAGATGTCCTCGTCATCGAAGGCGTATTCGAGCTGCCCCGTCA
TCGCCTCCGCCACCGTCGTGCTGTTGGGGTCCTTTCCCTGGGACACCGCACGCACCACGATGTC
GCGGTCGGTGATGATGCCCATCAGCCGGTCACCATCACACACGGGCAGCGGGCCCACGCTCAGC
TCGCGCATCTTCAACGCGGCGT
3920 edit
Amino Acid Sequence - raw
1519..3420
pI: 7.820819854736328
1019
MTLGRVCGGVSPRLKSLVLLLAVLTAAALWRAGQETQTPASPETPPAVSPSLDDEALTPAPEEN
LPGVKGRERVLVVGHRLRYTFDLDLRTHTENRAGARESLHTGWSGLFELTYLGAEGEQHLFSGH
LVPTRVAVESGETLAPGDAAMQALRGMFERPVYVGQDVRGRVMAVHFDAAQDATARRLVRLLLA
STQFVAEDGPRWSTEEPDSRGDLEAVYRAGGSANTYVKTKRRYLRAGSAVLPRLQGHLDFTLFA
DGHVKEATGSDVVELGGGSTGLPRIREEARVALTNVGVDYRLSSLRPFEATRTTLRSERLTDSA
DMEGASLEARDRQLVKGVKLDDLLRALAKREDLDTARLRLTALFRQNLAEVERAVALIRQGSAD
AVRSEQILEALASAGTPEAQRALVSVLEGERVRPKTRAHAARAAGRMERPSLLLGDALERVMDG
TRDAGVRNAAALSMGALSKTLEVAEPGRSQALVEGIVRRCRTGALEPEVCLDALARAGAPVGLA
YVKSALVHPEADVRGAATKALSAIPGAAVDALLDQVMLDDPSPRVRALAVKAVSQRVTGAHLEV
LARVLRSERSERVRIEVVRLLGHLQAVEAPAAALLRDVAANDGSANVRALAASLLGE
3920 edit